.
The Open Protein Structure Annotation Network
PDB Keyword
.

392091

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 392091
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS27715,JANN_22DEC04_CONTIG23_REVISED_GENE1433, 429800 Molecular Weight 17606.06 Da.
    Residues 158 Isoelectric Point 4.89
    Sequence ltdtddlalriyqaildgsgdavnlrdfdrflpffhlpklletfegrrmietpdalhvafnklqrllrd igaarmlrtctvaqfdgpdtirgvhdtrlvdddgtvieaysgmctlrlvdghwrttasqfaeekasvps kmlqgevdpafavaempvap
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch