.
The Open Protein Structure Annotation Network
PDB Keyword
.

392191

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 392191
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS27723,YP_001093158.1, 323701 Molecular Weight 23356.26 Da.
    Residues 201 Isoelectric Point 5.19
    Sequence mnnvlilypklfncyskfsrkvlkitsslgaatlvypddpngliekfceessgkmtnkefpnwtpddit haiifddgeefieeterlkeskkplrligicitrvinikteteyqsekstpiyeyigrgsywgnpysmf eegedreevirkykydfdfekfpnkeksevyklagkrlgcfckpqachgdvladflnswddgk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch