The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 392242
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS27731,MMAG_12JAN01_CONTIG3879_REVISED_GENE4148 Molecular Weight 40857.98 Da.
    Residues 378 Isoelectric Point 5.96
    Sequence mgkphrialalqgggvhgaftwgvldalleeaatgkiefvgvsgassgaltatamaygyhegaaqpgpa sarsrrmaeaartkirelwetvaraafwggnpfvaaiglaqdwniddtpaarwadvaggntpaaesglg tyltavlrdvlpqipaifalpqegtptlivaatdigecrrqlfidgavspdavrastnlptslhtvsig dhhywdggymgnppltplverlretnaedlvlvtlnplhrdgpppkggrqvldrlnevafnaslvhevn aietinrlvdadmikepppgqhpyrrvnlhrihadeemvklgvyskdapawdflvylrdlgrkaftesw etirpalgkhsswdtnsvcdqilarkaittrek
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch