.
The Open Protein Structure Annotation Network
PDB Keyword
.

392505

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 392505
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS27753,RER070207002725 Molecular Weight 16466.80 Da.
    Residues 148 Isoelectric Point 4.65
    Sequence msrnienhdsvlllqdciagckmalesmddirehtddkqlrelidkyydehtglsvdcrdmldkagadi kepgvfakmaaklqtamkmavnddqsqaaklltegcnmgietisgslneyrdadsksvaiaerlrtlee kmvgdlqpll
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch