The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 392728
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS26569,YP_001338252.1, 531905 Molecular Weight 12510.77 Da.
    Residues 120 Isoelectric Point 8.53
    Sequence meqitviigdrlgkgqkvaagaekagaravvvpgvaadmklgdimkaenatfgisfcgsggagaitaqt kygykakygmrsidegvtainegcnvlgfgfmdkeelgerlveawkkkyga
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch