.
The Open Protein Structure Annotation Network
PDB Keyword
.

392951

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 392951
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS25245,NP_812691.1, 324886 Molecular Weight 40886.96 Da.
    Residues 364 Isoelectric Point 8.13
    Sequence gqpsndkknvlpdwafggferpqganpvispientkfycpmtqdyvawesndtfnpaatlhdgkivvly raedksgvgighrtsrlgyatssdgihfkrektpvfypdndtqkklewpggcedpriavtaeglyvmty tqwnrhiprlaiatsrnlkdwtkhgpafakaydgkffnlgcksgsiltevvngkqvikkidgkyfmywg eehvfaatsedlvnwtpyvntdgslrklfsprdghfdsqltecgppaiytpkgivllyngknsasrgdk rytanvyaagqalfdandptrfitrldepffrpmdsfeksgqyvdgtvfiegmvyykdkwylyygcads kvgmaiynpkkpaaadplp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    Pfam update: This is a member of DUF377, which is likely to represent a novel glycosyl hydrolase enzyme. I see JCSG has already solved a structure in this family PDB:1vkd.

    Another recent JCSG structure of a homolog is available, and the TOPSAN page for that target 393092 has more information.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch