The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 392970
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS24357,NP_809679.1, 324884 Molecular Weight 24949.00 Da.
    Residues 226 Isoelectric Point 8.22
    Sequence aqtdpsqlkkegsdafnaknypvayakfseylkqtnnqdsaiayycgmaadevkkyaeavtffdiaiqk kfnignayarkalaldamkktdeyvatleeglkvdpdnktmiknyglhylkagiaaqkagkveeaeecf kkvipldhktyktnalyslgvlcyndganilkkaaplansdadkyaaekekadgrfkeaigyleeatkv spedtksktmlsqvqaamk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch