.
The Open Protein Structure Annotation Network
PDB Keyword
.

393031

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 393031
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS24363,NP_813172.1, 324974 Molecular Weight 16390.27 Da.
    Residues 148 Isoelectric Point 5.06
    Sequence cndtddvagiftgktwkltyitvkdshqmfnfwgndnkareqsmklldetgryvitfngmeesniitgt lsgtvitstftgswsangkdnqfnasiqggnessdilaknfieglnnatsyggdernlylyykpsgsqq tlslvfhvvk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch