The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 393130
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25754,YP_210994.1, 324039 Molecular Weight 14491.48 Da.
    Residues 134 Isoelectric Point 4.54
    Sequence aeeavadslavameptmeetqvyegvlpaadgpgiryvltlntlanatdttytldvtyldaegkgkdkt ftskgkpvkvektvkdkkktaiklnpsdgsepvyfviandttltladdslevsesdlnyniirvk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch