.
The Open Protein Structure Annotation Network
PDB Keyword
.

393179

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 393179
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS66213,YP_001298218.1, 324152 Molecular Weight 36719.16 Da.
    Residues 325 Isoelectric Point 4.30
    Sequence avvscdsilgeeevdcsveyrvkfkydynmkyadafsrevgtvtlyafddngklvyqkteegdvlgeeg ytmkvdlepgdyhlvtwaglndeasfsvplvtagessldelqcrmdrlysraadgtavvnsklsalwhg evtkqsfsraassqvvtvplvkntntiriilqqmdgvtvevdkfeftitddnglmnydnklledetlty ypyyrmqggtdmgiradgdaedsnisvaiaqitvgrlvvennprltitnketgepvlsiplvkylllte aeghemtnqeyldrqdeynmtffldesmkwintsiiindwvvrfneldm
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch