.
The Open Protein Structure Annotation Network
PDB Keyword
.

394071

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394071
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS30964,NP_662308.1, _0046.002759_, 326860 Molecular Weight 36655.06 Da.
    Residues 337 Isoelectric Point 5.82
    Sequence meakkskaivfsgvnqielrevtlkpvsstdvlvetwwssistgtekmalnglipsppfifpfipgyet vgriveagdhvnqgligkfayvagsfgyedvnaafggasqfivcpvesltvldgianpqcgialplgat alhivdlaevknrkvlvlgqgavgilaaelakrfgaslvavtephqrrldistsdikvnpekqdvsval aghefdvlidstgimsaietglrflkfhgkvifggyyqrmnidysqafnkelsfiaarqwakgdlhrvr eliaagkinaekifthqctvddnlmeaymqafsdsdclkmiihwkhgneagehfptcntan
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch