The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394122
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS29502,YP_926018.1, _0081.000680_, _0106.002175_, _0028.003068_, _0084.003671_, 326775 Molecular Weight 44158.68 Da.
    Residues 398 Isoelectric Point 7.66
    Sequence madraseaeliklpvskltrgmfvaaienngkvavanagqiksretiaklvksgihhvwvdaerssdes glkpksaqgsaapaagavrpsranrdlrqtqakkllheakelirkvlsetfegkaievkpfealadnmi esimldddalkcvsalrdkdayllehsvnvafllvtfgkylkldretlkqmavggvlhdigkikvdnki lhkpgkltpeefehmklhqfyamdimseasalsqiskdvclmhhekldgrgyprglkgdeiplhgrmsc ivdifdaltatrcykeamspaaafkillsltpfhldtdlvyefircigvypvgslvelsdgrvgivwes kdrdalspvvkcfyslkhkrytevnfvdllksdlniergvspssldvdpkpfy
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch