The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394210
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS25785,YP_546073.1, _0098.002086_, _0028.002338_, 326979 Molecular Weight 46340.01 Da.
    Residues 413 Isoelectric Point 5.30
    Sequence mlsgkyvcmtqdqayigrqpimnplqeivayelffrhsaeatsaiyenslqacnrvlvntlndmgtqwl lgdklaflniseemlhsellellppaktvlelealvapspevlercrflrrrgyrialkdkgaslvgsa liddadyvkidilaytmdevarrfleyqilgvtvvaekvehhhhyeacrqigfhliqgfyfahtetfta kvinpafavvldllnmisrdadlrdiengfkrdaalsfkllryinsvgfglsceiqslrhaltiigtkq lyrwltllmvtagenaaapalmktsitrgrltellgdgyfdktgrdnlfvtgvfsmldlmlempmervl ekidlpeaiqdallhrqgiygpflqlaeacesqdssriialadslqldpnkvndahvaalawvealgv
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch