.
The Open Protein Structure Annotation Network
PDB Keyword
.

394220

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394220
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS27839,YP_001093982.1, _0108.0002956_, 332934 Molecular Weight 39513.20 Da.
    Residues 356 Isoelectric Point 4.78
    Sequence msfknfkcvpkmifgrgsfaqldtvleeerkqgddfvvfliddvhqdkplaqrvpakpqdlviyvnvdd eptteqvdnlteqvqafnsklpvsviglgggstmdlakavslmltnpggsamyqgwdliknpavhhigi ptvsgtgaeasrtavlcgpvrklglnsdytvfdqiimdselidgvptdqwfytgmdcyihcveslqgtf lnefakafaeksmdlcrevflddhpekddklmmasymggmsiaysqvgachavsyglgyvlgyhhgign clafdvleefypegvaefrqmmdkhnitlpknickdlpdetiakmvavtksmgplwanvygegweekvt demltklfrri
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch