.
The Open Protein Structure Annotation Network
PDB Keyword
.

394280

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394280
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS27841,YP_509991.1, _0023.002889_, _0052.000516_, _0036.000262_, 325456 Molecular Weight 18632.09 Da.
    Residues 175 Isoelectric Point 4.97
    Sequence mhpiiydvavsldgyisgpsgdiskfahdgpvvddyaarlggyktaimgrktyefgydyglepgqnpyp nmntivfsqtlecpersdiqvvksasksdvlslkktadgpiylcgggafagwllgeglidrlvlkrapc vlgggvslfgggsaaapfskvtaktyengyvleeydl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch