The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394306
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS27845,YP_001166108.1, _0052.006031_, _0003.000446_, 333044 Molecular Weight 35375.76 Da.
    Residues 337 Isoelectric Point 4.90
    Sequence mrcadftgpgqivfrpaatpptpgpgevlvavrtcgicgsdlhmfrdnsyrdklvretvegyavpghef agtiaalgdgvagwsigdrvvgvtgmgggmadlvavpanpwqlvkvpdglswelaattepladglqmvr kgaptdgenvvvigvgiiglgviqailargispariiavdvhqtrldtalqvgathavnardgdvfeai gaicgigetyagqsanisvifdcagyirhmkgpppletalrlvvpggrivcfggfegrmeidmspliek qptifgsngyapeelvealdlmsggkvdraclishefpleqvaeafdrqlqpdavkvmlri
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch