.
The Open Protein Structure Annotation Network
PDB Keyword
.

394340

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394340
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS30716,YP_001087037.1, _0037.001841_, _0073.006261_, _0072.001003_, 424124 Molecular Weight 37763.50 Da.
    Residues 331 Isoelectric Point 5.34
    Sequence mrnlgntnmkikrvgfggipiqritqddtnlvinelekqginfidsargytiseeaigiaiegkrdkff latksmsrdydsmkrdveislnnfktdfidlyqfhnvkeeeydnlfkdkmaysalleakeqgkikhigi tshnlntiekaiedgkfdtiqfpynivegqadevfkkahekgigiivmkplaggaldnatlaikyilsk dyidvvipgmesveqvrqnvavlenlvldekdnkeieeirnslgkkfcrrceycmpcavginiplsflc egyytryglkewakekyevmdvkptecidcglcesrcpyelpiremlktvveklg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch