.
The Open Protein Structure Annotation Network
PDB Keyword
.

394345

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394345
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS25304,NP_242259.1, _0031.003060_, _0066.001282_, _0023.001152_, 333018 Molecular Weight 58984.42 Da.
    Residues 518 Isoelectric Point 7.11
    Sequence mkrqrlaiidigsnsirlvintinehghyqelynfktvarlsnhldaqgnltkegtsillttlqkfrtl tedhhcdraivvataamrkannrkellklaeqetgfsikllseyeeayfgylaivnstsiqdgitidig ggsteitrfsnrkllhyhsfpfgaitlyrdffhstdpseeelaslqtflesafatlpwlqdakdlpvig iggtarnlslihqrqtdyplaglhqysfpaeelhsvtqmlqrltsseregldglskdrvdviipgtqai sslvktigssqfimsrkglrdglfyseileqlnlecfpnvveesfyqlyhqyeinlehvkqvaklatkl yeqlapfyngklehqqnltlihraarvlylgehinpeassqhtfylltnmsidglnheerlalacvssf kskaqllhmaspfmpliskkqlkrfeflgailklayclnrtrrhvigkigtieakrdalvlplyyhydl dpsfeqdyalkhvkhvekvikktielpflplsnft
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch