.
The Open Protein Structure Annotation Network
PDB Keyword
.

394458

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394458
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS26637,DHAF_12NOV03_CONTIG1083_REVISED_GENE3088, _0074.003621_, 325455 Molecular Weight 30481.31 Da.
    Residues 280 Isoelectric Point 4.77
    Sequence mqnvnsafeycdqlvkdferviehpivskssvyytgidlgtayivlavldenyqpvagayrfanvvkdg mvvdyigairivkelkqeleerldtelvyaaaalppgtmaldsgvikhvvqgagfeitnlldeptaana vlkikdgaivdigggttgitilkdgeviyvadeptggthfslviagaykmsfdeaenykqnpknhrelt pvvgpvvekvssilnrhlrdyqvetiylvggtcclegietiiarqtgiptykpqnpmfvtplgialnct qeil
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch