The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 394462
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS26639,MMAG_12JAN01_CONTIG3829_REVISED_GENE2115 Molecular Weight 19117.88 Da.
    Residues 173 Isoelectric Point 4.77
    Sequence mtfnktiiprvmasilgqtrevlaaeaviavdgaetfdcdvtklhlhdmtviaglggpislliafsfet slvealfhrvtadievppgeedlyrretaaeivntilglcttdfqnieesialsppviiedarcihrpk navfasmrirtergivsvsfvgprdlfddhmnyqf
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch