The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394494
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS25324,YP_323831.1, _0005.004622_, 333007 Molecular Weight 34846.31 Da.
    Residues 314 Isoelectric Point 6.08
    Sequence mtrtegkillkpdtlweqvkkqteyalncgallsiptefefveqdgvnflvrilsnldrknadkkkrek ksagkefnpflpyeqdlfvadisdthvcifnkfnvvdyhlliitrdfeeqeklltladftamwaclagi dglafynggklagasqrhkhlqlvplpftasatqipiapllasakfeesiatipglpfvhafaslqpaw vdsplmgadatleiyhkllravglgavgddrqsgaynllatrewmlivprsqehfqsisvnslgfagal lvknasemqilkqhgpmnilkevaiaygetkpiainsy
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch