.
The Open Protein Structure Annotation Network
PDB Keyword
.

396133

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 396133
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS29528,14601450 Molecular Weight 14696.99 Da.
    Residues 139 Isoelectric Point 5.32
    Sequence vkidegedvhsvlsslaeaedlgfamvtgiggmaeatvafysppeatyytvdvkppegrvievaamtgn ivktsqgysvhihvalgvspgksisghlvkgvvkpfmevfvvelvsgqgtpgtsvfdhregfkasykrle
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch