The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396278
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS25410,NP_417233.1, 3.40.630.10, 332868 Molecular Weight 35341.11 Da.
    Residues 321 Isoelectric Point 8.99
    Sequence sspkpgdfantqarhiatffpgrmtgtpaemlsadyirqqfqqmgyrsdirtfnsryiytardnrkswh nvtgstviaahegkapqqiiimahldtyaplsdadadanlggltlqgmddnaaglgvmlelaerlkntp teygirfvatsgeeegklgaenllkrmsdtekkntllvinldnlivgdklyfnsgvktpeavrkltrdr alaiarshgiaattnpglnknypkgtgccndaeifdkagiavlsveatnwnlgnkdgyqqraktpafpa gnswhdvrldnhqhidkalpgrierrcrdvmrimlplvkelakas
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch