.
The Open Protein Structure Annotation Network
PDB Keyword
.

396453

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396453
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS26669,SFRI_16AUG04_CONTIG85_REVISED_GENE2613, 3.10.450.50, 327556 Molecular Weight 16160.45 Da.
    Residues 140 Isoelectric Point 5.28
    Sequence nigdmpreqqlamqymealtdhdytvlrrfysrdtvfydktanttytggrhiiaflqrahegvleyrln vehmfntgslvviigsyrlrgpgdqygkpgkiidlavpgvttlkfdnnterlieqmdlmdyqtmsdqle sq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch