The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396493
    Molecular Characteristics
    Source Silicibacter pomeroyi dss-3
    Alias Ids TPS25422,YP_165354.1, PF03968, 327589 Molecular Weight 14532.52 Da.
    Residues 141 Isoelectric Point 4.57
    Sequence egtkvafgavkadptlpvevtadsldvsqedgsaefqgnvlvsqgemrlsakrvlviynqeasgierle atgdvvlvsgsdaaqaqradytigtgvivmtgdvlltqgknalssgkmtvnltsgtaqmvgrvktilns gsd
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch