The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396636
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS29574,YP_001303747.1, 327031 Molecular Weight 38893.50 Da.
    Residues 346 Isoelectric Point 5.78
    Sequence kpgevwpddkgvhinahgggilrvgdtyywfgehktegsagnlaqvgvhcysskdlynwkdegialsvv pddttshivkgcvlerpkviynkkndqyvmwfhleprgagysgalsgvavsknvagpysfvnafrpnag fwpvnvqelhkqpctfsadlrfsggelpahpdslnllgrdqisgqmardmnlfvdddgiayhiysseen stlhisqltddytsysgkyarffpgrfmeapalfkqkgkyylimsgctgwapnagrsavassiwgpwke lenpfrgensevsfysqstyvlpvpghadrfiymgdrwtpenaidgryiwlpirfegeqpviewrsewsy
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch