The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396758
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS26692,MMAG_12JAN01_CONTIG3833_REVISED_GENE2185 Molecular Weight 15005.35 Da.
    Residues 136 Isoelectric Point 7.80
    Sequence mklqkatrcalfailelasgqdrqlsaneiaekygistnhlakvlrslgrvglveavrgagggyrfsgn rrrttlldiiqlfetidpirngeredgddtaegkglcqvlmeiedtaratfasitldtmiklvekhr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch