The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 397201
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS30545,NP_343793.1, _0061.003249_, 534605 Molecular Weight 48581.87 Da.
    Residues 425 Isoelectric Point 5.20
    Sequence mskenifdalksgkidyvrvefvdilgntkgrslrraefenvindnkgvdypeslalmdykdrpiksry ediiaipdlntfvaipylertarvlsflaqpdglpypycsrsilnkaieklkeagytlqvsfeptfyll nsalnpadyskafsleglleqqnflkllikyleeidikvetinkhygpgqyevklsqkpvleaadslis srevirdtakmnnviatfmpkpfkdypsssmditlslqtvdgkdimydpndskgiglskiaynfisgil ehlpsilsiaaptvnsykrfkevvtpnmpgigserhyivrlpsyykdthqvefrladplanpyillasm iyagldgiernlmanvneyygtlpqtlkeslsrlendtymkynlgqdlisiyiniknieieeyesqite werdyylkagw
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch