.
The Open Protein Structure Annotation Network
PDB Keyword
.

397286

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 397286
    Molecular Characteristics
    Source Rhodospirillum rubrum atcc 11170
    Alias Ids TPS30546,YP_427093.1, _0073.006185_, 327780 Molecular Weight 42563.20 Da.
    Residues 407 Isoelectric Point 5.73
    Sequence maaaldgirvldlsrvlagpwasqaladlgaevikierpgagddtrswgppflkdedgrettdaayfla anrgkksltvditkaegqdlvralaarshvvienfklgglakygldwpslravnpalvycsitgfgqtg pyapragydamiqamsglmsvtgepdgvagggpmkvgvavtdiltglyaafgilaalrhaeatgegqhi dlalmdtavacmanqaanalvgervpgrlgtahpnivpyqafatqdghlmlavgndgqfarlcaigqrp dlpldprfarnrdrvahraallaeiipmmasrstdawiaalesagvpcgpintldrvfadpqviarglr vdgthaeagtvpmvrnplllsatppthtagpptlgqhtdgvlsdvlgltaedittlrqkaiv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch