.
The Open Protein Structure Annotation Network
PDB Keyword
.

397414

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 397414
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS30547,YP_557337.1, _0093.002836_, _0037.002508_, _0061.000710_, 341328 Molecular Weight 42994.50 Da.
    Residues 382 Isoelectric Point 9.17
    Sequence mkpalkstpalritlvcntawaiytyrqglirmlvgrgvdvtvlaprdrtfellvamgcrcielpvask gtsprddlrtlyalyrqyrsirphvvfhytikpniygsiaarlagvqsvavttglgyvfiqqsraaqva kklyrfafrfpreiwflnrddqaafveqnllvhperarllhgegvdleqfaftplperadyrfvligrl lwdkgvgeyveaarrlrerypharfqllgpvgvdnpsaitreevaaweregiieylgeahdvrpfiaea dcvvlpsyregvprtlmeasamgrpivttdvpgcrevvadgvngllcearnaaslaatlarmldmsgae rralaergrkkvaeefdervvvemykdlvqkmtgvll
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch