.
The Open Protein Structure Annotation Network
PDB Keyword
.

397796

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 397796
    Molecular Characteristics
    Source Thiobacillus denitrificans atcc 25259
    Alias Ids TPS30548,YP_313832.1, _0108.0000801_, _0063.005128_, _0032.003345_, 531954 Molecular Weight 37454.87 Da.
    Residues 334 Isoelectric Point 6.27
    Sequence msdiqlsllndfqrgfpltstpfdaiaqrlgldvealldtlrrltregvvsrvgavfrpnrvgvstlaa mavpegrldevarlvsarpevnhnyerehrfnlwfvaaaanpaqleqalhdieqqtglaamrlpmvqdy hidlgfdlrrsvgltdrhqqkaapsraleldaldyvlveaiqeglplvarpyaevaafigtseadvlir lgrlldhgvikrlgivvrhhelgfranamvvwnipdeqvdefgrcvgasglvnlcyqrprrlpewpynl fcmihgkdrdavlehldhlrdqcgltdfpcevlfskrrfkqtgarylaaqpkaaaeat
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch