.
The Open Protein Structure Annotation Network
PDB Keyword
.

398136

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 398136
    Molecular Characteristics
    Source Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
    Alias Ids TPS29630,YP_009533.1, _0086.000444_, _0056.000414_, _0115.003225_, 328074 Molecular Weight 33100.84 Da.
    Residues 306 Isoelectric Point 5.14
    Sequence mqysweqveafvraarlgsfsaaarelgkaqsavstaianleadlgvnlfdraghlpvltpegeallgd aerllargerfgsraatlatgveprlvlavdelawgpalvdrltgfaerwpdvemeflfgivgdialmv aegrahmgimvpladprgrrvyaeeawrdaesrlagldyfpagavpalpvvaaghplagrravspdele alrqlditsrggerpdalsgqvwrvdsywalrdlvraglgwaylpeslaasdldagrlvrldlapagev wrwplylvrdarrapgpaarwllealakav
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch