The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 398570
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS29652,YP_324771.1, _0003.003178_, _0078.001791_, _0004.003959_, 326424 Molecular Weight 33182.54 Da.
    Residues 289 Isoelectric Point 4.96
    Sequence mfsiaiqqqqyktyilsdettgsqlevvperggiitrwrvkgeeilyldaerfthpdlsvrggvpilfp icgnlpdnsytlngqqytlkqhgfardlpwevveqttkdtaaltlvlrsneqtkavypfdfqlvftyvl qgntleirqeyqnlsstqlpfsagfhpyfltgdknqlefdipsqeyqdqqtkevhpfngnfdfnrdemd fafghitsqsasvidrnrqfkltldaddifsmlvfwtlkgkefyclepwsaprnslntgekltvlepgt sykasvrlsasff
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch