.
The Open Protein Structure Annotation Network
PDB Keyword
.

398825

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 398825
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS30570,NP_840675.1, _0057.000943_, 326882 Molecular Weight 29136.94 Da.
    Residues 259 Isoelectric Point 6.01
    Sequence mdlssnrlagksilitrplhqagglatwvrelggepwlfpvleisdsenkqplldliarldefdlavfv spnavekviplvqvshswprhvlvatvgkgsarvlerygitnvivpeegsdseallrmpqfqvmqgrhv vifrgndgrrllgdtlrergasveyiecyrrhkpeadplpllkhwrddgiqaviisssegldnlfdmig etgqqllkatpvftaherierkarelgirkiyrtllgdegtvqglleyfekm
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch