The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399105
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS30580,YP_001048464.1, _0018.007245_, 323513 Molecular Weight 25206.55 Da.
    Residues 215 Isoelectric Point 6.59
    Sequence mktrdkiiyaslelfnehgernittnhiaahlnmspgnlyyhfrnkediircifslyenhlesgfqpye dkqvdvelligyfdamfytlwqfrfmyanladilardeelkkrylhaqqqvltrsshvlhklkqdgflh lesdkitpladtikmivsfwigyqltqsststitkatlyegvlrvlmifkayatptsvatftrleqhyh alanqesl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch