.
The Open Protein Structure Annotation Network
PDB Keyword
.

399217

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399217
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS29700,NP_715835.1, _0043.000310_, _0056.003335_, 324814 Molecular Weight 22735.99 Da.
    Residues 203 Isoelectric Point 5.58
    Sequence marrkehshdeirvmaieaaiallqqqgvqglslrkiaseigyvpstlinifgsynylllavseatlql lmshlsavsendslrhiivmaqkysefahsqrqcfklvfelqllesehlpasqgqlianlfrlienela llfpnetieqqlqmsrvlwggihgltalsldnklfadtvslpalleshvtgylqgmgyqreeacc
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch