.
The Open Protein Structure Annotation Network
PDB Keyword
.

399565

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399565
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS29746,NP_470173.1, _0054.001598_, _0019.001778_, 327206 Molecular Weight 18486.29 Da.
    Residues 156 Isoelectric Point 6.46
    Sequence mdkneqvmanvrdlfnklawinkvkmekalegykpsevhciefiaknedpnvtklaeafymtksaiski tkklmdkgyiesyqkpenkkeiyfrlttkgaeinqvhdnlhqefldrdkvvfedvsdkqyeevlqfvdk ysrhldaemkkildrkse
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch