.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b5p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of CADD-like protein of unknown function (ZP_00108531.1) from Nostoc punctiforme PCC 73102 at 2.00 A resolution (monoclinic form). To be published
    Site JCSG
    PDB Id 3b5p Target Id 377778
    Related PDB Ids 3b5o 
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1931,NPUN_22DEC03_CONTIG1_REVISED_GENENPF6505 Molecular Weight 27098.38 Da.
    Residues 243 Isoelectric Point 4.63
    Sequence mefnhltkqlnqllaqdyvafsitenpvvqmlsqasfaqiayvmqqysifpkelvgftelarrkalgag wngvaqelqenideemgsttggishytlladgleeglgvavkntmpsvatskllrtvlslfdrqvdyvl gatyaieatsipeltlivklvewlhegaipkdlqyffskhldeweieheaglrtsvaayiqpeefgefa agframidamqvwwqelaqeaissevvlstaiaqhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.33 Rfactor 0.167
    Waters 143 Solvent Content 47.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene Npun_F6505 from nitrogen-fixing cyanobacterium Nostoc punctiforme pcc 73102 encodes the protein ZP_00108531, a  CADD-like protein of unknown function. Superposition between protein structures encoded by CT610 from Chlamydia trachomatis (PDB:1rcw), pyrroloquinolinquinone synthase C (PqqC, PDB:1otv) and ZP_00108531 (PDB:3b5p) revealed that putative active sites in CT610 and ZP_00108531 are identical. The substrate binding residues in PqqC active site are different then in CT610 and ZP_00108531. Thus protein structure superposition and sequence conservation [alignment; note: conserved His186 is missing in the protein structure] indicates that the function of ZP_00108531 is similar to that of CT610 protein.

    Selected residues superimposed between ZP_00108531 and CT610:
    ZP_00108531 - CT610           
    His178 - His174
    His94 - His88
    Phe174 - Try170
    Glu84 - Glu81

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch