.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ch0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3ch0 Target Id 367128
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS1502,YP_677622.1, _0090.002659_, 86437 Molecular Weight 30676.72 Da.
    Residues 271 Isoelectric Point 5.62
    Sequence miqvpasfdiqghrgcrgllpentiaaftkalllgvttlefdlviskdnrvvvshdtffhheitmmvdg edvteaneknfnlyamnyadikeidvgmkthprfksqkkvpavkplfrelietaeklsakiqyngeiks tvegdnidhpnialfcdlvvaeikkahitdrftlqsfdvraleymhsqypdiklsylvetkgtlkkqle klsftpavyspdvtlvskkdidaahklgmrvipwtvntkeeietlislgvdgiitdypdlffek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.189
    Matthews' coefficent 2.77 Rfactor 0.158
    Waters 415 Solvent Content 55.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein is annotated as glycerophosphodiester phosphodiesterase (GDPD)
    and in the PF03009; GDPD pfam family. biological subunit appears to be a monomer.
    The structure contains two domains - TIM barrel domain (blue) and the insertion domain (red).

    There are several homologs found in PDB: 1t8q, 2o55, 1o1z and 1zcc.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    monomer_FH7626A.png
    No description
    84.41 kB22:03, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch