.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cjm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative beta-lactamase (NP_815223.1) from Enterococcus faecalis V583 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3cjm Target Id 389964
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS1781,NP_815223.1, 87293 Molecular Weight 31799.95 Da.
    Residues 281 Isoelectric Point 4.99
    Sequence akeseqkvtidsakhekhtkdkeennsantvffdkindllvasvkefegtvgisyldletgeqrsvngq hefytastikvpltmlvadtvasgqkkwtdlipynaeedyeegtgiiayniqpeyplktlqeyaitysd niaknmlydtlggdakakremyqrylhktpsieepqfssedalvilqklytekatkpdyqaiydsmkqs vfhermetpttqgkvahkigsydefihdmgiletphpfalaiftkgpdnaksaafiasvtdklwqlqvs eypnq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.172
    Matthews' coefficent 2.31 Rfactor 0.147
    Waters 352 Solvent Content 46.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cjm
    1. Analysis of the plasticity of location of the Arg244 positive charge within the active site of the TEM_1 __lactamase
    DC Marciano, NG Brown, T Palzkill - Protein Science, 2009 - Wiley Online Library
     

    Protein Summary

    389964 encodes a putative beta-lactamase. Structurally, it is similar to proteins in the beta-Lactamase/D-ala carboxypeptidase family from SCOP. It has sequence similarity to COG2367: Beta-lactamase Class A (CD-search E-value: 2e-14 and ffas score: -71.800).  It is expressed as a gene truncation of residues 33-313. Additionally, residues 34-58 and 313 are disordered and not visible in the final model (Fig 1). Both the fold and active site residues of 389964 are conserved when compared with other beta-lactamases.


    Figure 1. 389964 forms a monomer. The N-term is blue and the C-term is red


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    389964_figure_1b.png
    No description
    235.83 kB22:06, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch