.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dao

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative Phosphatase (RER070207001050) from Eubacterium rectale at 1.80 A resolution. To be Published
    Site JCSG
    PDB Id 3dao Target Id 388491
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7523,YP_002937310.1, 87570 Molecular Weight 29797.73 Da.
    Residues 264 Isoelectric Point 4.95
    Sequence mikliatdidgtlvkdgsllidpeymsvidrlidkgiifvvcsgrqfssefklfapikhkllyitdggt vvrtpkeilktypmdediwkgmcrmvrdelpacdyfaatpdfcfaedggspifhllrdsygfemrevdd itrldrndiikftvfhpdkceelctpvfipawnkkahlaaagkewvdcnakgvskwtalsylidrfdll pdevccfgdnlndiemlqnagisyavsnarqeviaaakhtcapywengvlsvlksfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.208
    Matthews' coefficent 2.21 Rfactor 0.168
    Waters 684 Solvent Content 44.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dao
    1. Comparison of structure_based and threading_based approaches to protein functional annotation
    M Brylinski, J Skolnick - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary

    Gene EubRec_1417 from Eubacterium rectale encodes the YP_002937310 protein, a putative phosphatase that has sequence similarity to the haloacid dehalogenase-like hydrolase family PF08282 (E-value: 5.3e-43).  The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification.

    Pre-SCOP classifies 3dao in the alpha/beta class, HAD-like superfamily. 3dao structure consists of two HAD-like repeats, each consisting of a beta-sheet flanked by alpha-helices (Fig 1). There are two monomers in the crystal assymetric unit. These monomers do not superpose well. However, a superposition based on a single repeat only shows a domain motion between the monomers (Fig 2). There are numerous phosphatase structures that are structurally similar to 3dao (Fig. 3).

    GD4050C.png
    Fig 1. 3dao monomer structure consists of two similar domains.



    domain_shifted.png
    Fig 2 : The 3dao dimer superposition highlights the domain motion between monomers.

    all.png
    Fig 3: 3dao (orange) is superimposed on a sugar phosphatase SUPH (PDB code: 2hf2; Z=29) shown in yellow, ybiV from Escherichia coli K12 (PDB code: 1rlm; Z=28) shown in cyan, and TM0651 from Thermotoga maritima (PDB code: 1nf2; Z=27) shown in green.
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch