The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator of the TetR/AcrR family (YP_290855.1) from THERMOBIFIDA FUSCA YX-ER1 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 3dcf Target Id 390257
    Molecular Characteristics
    Source Thermobifida fusca yx
    Alias Ids TPS7704,TFUS_04MAR05_CONTIG93_REVISED_GENE761, _0076.003088_, PF04967, _0016.000804_, _0073.003939_, 87929 Molecular Weight 24765.52 Da.
    Residues 217 Isoelectric Point 6.03
    Sequence vgqrsdsdhvmaeattdkrqghtrgrtgndrrtqiikvatelfrekgyyatslddiadrigftkpaiyy yfkskedvlfaivnsivdealerfhaiaagpgspgerihallvehtrtilrnldantvfynergllspe reremrkrereyteimqrlyaegvatgelldvdptvatatllgaaiwtyrwydpegrlsadevveqitr lllngyrrpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.277
    Matthews' coefficent 2.29 Rfactor 0.241
    Waters 71 Solvent Content 46.25

    Ligand Information



    Protein Summary

    The protein YP_290855.1  from Thermobifida fusca YX belongs to TetR/AcrR family of transcriptional regulators with the PFAM assignment of PF00440. The architecture of the protein is all helical. The monomer structure is shown in Fig 1 while the biologically significant oligomer is dimer (Fig 2).

    Fig 1. Monomer structure

    Fig 2. Biologically significant oligomer is a dimer.

    The structural homologs of this protein are numerous. For example: 2nx4 1u9o 1u9n 2np5 2gen 1t56 2gfn. The structures are nearly identical with this target.

    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch