.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dcz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative RnfG subunit of electron transport complex (TM0246) from THERMOTOGA MARITIMA at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3dcz Target Id 358404
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS6043,TM0246 Molecular Weight 21301.49 Da.
    Residues 195 Isoelectric Point 5.77
    Sequence kgkiqeadnaaklsaikfvlkdpltgdylvdekeieeivkktgietvvlkeykegvvlgplyefvtkdg rnayvlsgyapgfggnvtvvacfiktedgfmlnsvrvidysqetpglgakigeesiqrrffpvppeglk nglrvdkdaglpkgspeelkkqgivkvsdvmtgatitpravvtalnlmyryleevsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.205
    Matthews' coefficent 2.27 Rfactor 0.176
    Waters 146 Solvent Content 45.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dcz
    1. Biochemistry, evolution and physiological function of the Rnf complex, a novel ion-motive electron transport complex in prokaryotes
    E Biegel, S Schmidt, JM Gonzlez, V Mller - Cellular and Molecular Life , 2011 - Springer
     

    Protein Summary

    TM0246 is likely to be the gamma unit of the NA-translocating NADH-quinone reductase (NQR3 or NQRC subunit). NQR is found in E. coli and related enterobacteria and can serve as a model for the mitochondrial, H+-pumping enzyme (complex I). It is a member of FMN_bind family of PFAM (PF04205).

    Thermotoga NQR contains 6 subunit (TM244-TM249), all of which except TM0244 are membrance associated. TM0246 contains a single N-terminal transmembrane helix. TM0246 homologs are known to bind FMN covalently, however, no FMN was observed in this structure, this could be due to flexibility in the structure since several highly conserved loops are disordered in the structure (also other reasons). The structure of TM0246 is similar in part (~70%) to Inhibitor of Vertebrate Lysozyme (IVY) protein (pdb code  1GPQ). This is first individual structure from NQR complex.
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch