.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dka

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a DinB-like Protein (NP_389123.1) from BACILLUS SUBTILIS at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 3dka Target Id 389728
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS9382,NP_389123.1, PF05163, 85463 Molecular Weight 17792.25 Da.
    Residues 154 Isoelectric Point 5.83
    Sequence mcqsnqivshflshrnvtnelaekiskdhysykpaetsmsaeelvkhiltsfhlfanvikegnaspfqn kqeetetdlnvlaktytektvaileqlteeqldreidltsafgrkvtgrallqlameheihhkgnlfvy vremghtelpfyqqrm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.269
    Matthews' coefficent 2.07 Rfactor 0.217
    Waters 98 Solvent Content 40.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dka
    1. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary

    The yjoA gene from Bacillus subtilis encodes the NP_389123 protein that belongs to the damage-inducible (DinB) group (PF05163). 3dka classifies into the SCOP all alpha class, DinB/YfiT-like putative metalloenzyme superfamily.

    Conserved histidines residues H48, H127 and H131 do not chelate Ni in this structure, as it is the case in the homologous PDB:3di5.

     

    See PDB id 3DI5 for more details.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch