.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dmb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative General Stress Protein 26 with a PNP-Oxidase like Fold (NP_637619.1) from XANTHOMONAS CAMPESTRIS at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 3dmb Target Id 380344
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS9376,NP_637619.1 Molecular Weight 15879.20 Da.
    Residues 146 Isoelectric Point 5.27
    Sequence madpkelqdkfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlgqgrrvi gafsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrldadhaqiwlngsslla gikvllgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.26 Rfactor 0.210
    Waters 64 Solvent Content 45.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dmb
    1. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary

    The XCC2264 gene from Xanthomonas campestris encodes a pyridoxamine 5'-phosphate oxidase found in all domains of life (PF01243, EC 1.4.3.5). 

     

    See 2RE7 entry for more details.

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch