.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dtt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative coenzyme F420H2:NADP+ oxidoreductase (YP_830112.1) from Arthrobacter sp. FB24 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3dtt Target Id 377840
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS9374,YP_830112.1, 104200 Molecular Weight 23340.29 Da.
    Residues 226 Isoelectric Point 5.42
    Sequence mkiavlgtgtvgrtmagaladlghevtigtrdpkatlaraepdamgappfsqwlpehphvhlaafadva agaelvvnategassiaaltaagaenlagkilvdianpldfshgmpptlnpvntdslgeqiqrtfpeak vvktlntmnaslmvdpgraaggdhsvfvsgndaaakaevatllkslghqdvidlgdittargaemllpv wirlwgalgtanfnfkiar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.199
    Matthews' coefficent 1.94 Rfactor 0.160
    Waters 553 Solvent Content 36.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dtt
    1. Binding Specificity of Recombinant Odorant-Binding Protein Isoforms is Driven by Phosphorylation
    F Brimau, JP Cornard, C Le Danvic, P Lagant - Journal of chemical , 2010 - Springer
     

    Protein Summary

    The Arth_0613 gene from Arthrobacter sp. fb24 encodes the YP_830112 protein, a coenzyme F420-dependent oxidoreductase (PF03807, COG2085, EC 1.5.99.11).

    3dtt structure adopts an NAD(P)-binding Rossmann fold. 3dtt shows significant structural similarity with oxidoreductase PDB:1jay (Z=25), PDB:2raf (Z=23) (topsan) and PDB:2vns (Z=22). For more information on the structure and function of the protein, see [Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch