.
The Open Protein Structure Annotation Network
PDB Keyword
.

3duk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (YP_544675.1) from METHYLOBACILLUS FLAGELLATUS KT at 2.200 A resolution. To be Published
    Site JCSG
    PDB Id 3duk Target Id 378221
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS14535,YP_544675.1, 3.10.450.50, 335793 Molecular Weight 13755.84 Da.
    Residues 124 Isoelectric Point 5.40
    Sequence msvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdlydwhnsngpa knvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkvfhlha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.2117
    Matthews' coefficent 2.39 Rfactor 0.1629
    Waters 216 Solvent Content 48.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3duk
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The Mfla_0564 gene from Methylobacillus flagellatus kt encodes the YP_544675 protein, a nuclear transport factor 2 (NTF2) domain (PF02136). HHPred gives strong hits with the association domain of calcium/calmodulin dependent protein kinase II (PF08332, P-value 3.8E-12 over residues 9-117) and scytalone dehydratase (PF02982, EC 4.2.1.94, P-value 6.2E-11 over residues 4-116). PSI-BLAST provides a hit with the C-terminal region of dehydrogenase ZP_05519550 (e-val=9e-6; seq. id. 32%; gaps 3%).

    According to pre-SCOP, the 3duk structure adopts a cystatin-like fold inside the NTF2-like superfamily, ketosteroid isomerase-like family. DALI top hits are with NTF2-like proteins 3blz (Z=20), 3fka (Z=17) and the ketosteroid isomerase-like protein 3d9r (Z=14).

     

    To do: compare presence/absence of catalytic residues to determine whether this protein could be a scytalone dehydratase.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch