.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dza

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3dza Target Id 390304
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS17999,YP_001337144.1, 89022 Molecular Weight 20033.54 Da.
    Residues 190 Isoelectric Point 4.97
    Sequence atdsataapaaaattqvqkeaadvlqvavqganamrdiqfarlalfhgqpdsakkltddaaallaadda swakfvktdakakmiadryviinasialsedyvatpekesaiqsaneklakgdqkgaidtlrlagigvi enqylmplnqtrkavaqsqellkagkyyeanlvlkgaeegivvdsemlvagn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.194
    Matthews' coefficent 2.29 Rfactor 0.152
    Waters 1106 Solvent Content 46.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dza
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The yfdX gene from Klebsiella pneumoniae subsp. pneumoniae mgh 78578 encodes a protein (YP_001337144) from the YfdX family found only in proteobacteria (PF10938). Predicted functional partners (score 0.75) based on genome context are the proteins hdeB, yaaI, yhhA and yaaW. A physical association has been shown with the uncharacterized ferredoxin-like ydhY protein in E. coli.

    Pre-SCOP classifies 3dza in the all alpha class, ferritin-like fold (?). A DALI search for similar structures returns weak hits with the metal binding protein SMBP 3dfb (Z=9), a designed helical protein 1y4c (Z=9), and cytochrome B-562 2bc5 (Z=9). 3dza structure lacks the first 30 residues of the YP_001337144 sequence.

     

     

     

    To do: search for more functional related data (e.g. expression arrays); look at zinc binding site(s).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch