.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dzv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 4-methyl-5-(beta-hydroxyethyl)thiazole kinase (NP_816404.1) from ENTEROCOCCUS FAECALIS V583 at 2.57 A resolution. To be published
    Site JCSG
    PDB Id 3dzv Target Id 375214
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS16169,NP_816404.1, 3.40.1190.20, 104040 Molecular Weight 29717.45 Da.
    Residues 272 Isoelectric Point 4.85
    Sequence mktsvkfetifplttapliqcitneitcesmanallyidakpimaddprefpqmfqqtsalvlnlghls qereqsllaasdyarqvnkltvvdlvgygasdirnevgeklvhnqptvvkgnlsemrtfcqlvshgrgv dgspldqseeaieeliqalrqqtqkfpqtvflatgiqdvlvsqeqvivlqngvpeldcftgtgdlvgal vaallgegnapmtaavaavsyfnlcgekaktksqgladfrqntlnqlsllmkekdwfeavkgrvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.57 Rfree 0.204
    Matthews' coefficent 4.15 Rfactor 0.175
    Waters 124 Solvent Content 70.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dzv
    1. New structural insights and molecular-modelling studies of 4-methyl-5--hydroxyethylthiazole kinase from Pyrococcus horikoshii OT3 (PhThiK)
    J Jeyakanthan, S Thamotharan - Section F: Structural , 2009 - scripts.iucr.org
     
    2. Purification, crystallization and preliminary X-ray diffraction analysis of ThiM from Staphylococcus aureus
    J Drebes, M Perbandt, C Wrenger - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary

    The EF_2777 gene from Enterococcus faecalis v583 encodes a hydroxyethylthiazole kinase (PF02110, COG2145, EC 2.7.1.50), adopts a ribokinase-like fold and shows strong structural similarity with other hydroxyethylthiazole kinase structures determined by structural genomics (e.g. PDB id: 1V8A, FATCAT P-value 0.0). Genome context, structural similarity and homology suggest that EF_2777 is 4-methyl-5-beta-hydroxyethylthiazole kinase (ThiK), a salvage enzyme in the thiamine biosynthesis pathway [Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch