.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function (DUF849) (YP_555544.1) from BURKHOLDERIA XENOVORANS LB400 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3e02 Target Id 381354
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS17738,YP_555544.1, PF05853, 104796 Molecular Weight 34101.21 Da.
    Residues 310 Isoelectric Point 6.01
    Sequence mkqskkiiitcavtgsihtptmspylpitpeeivkegvaaaeagaamlhlhardplngrpsqdpdlfmr flpqlkertdailnittggglgmslderlaparaarpevasmnmgslnfnisqaaakfdtfkfdwerpy lagtrdfilsntfsqiergmtelgasgtrfefecydvghlynlahfvdrklveppfflqcvfgilggig adpenllhmrtiadrlfgqdyylsvlaagrhqmpfvtmsailggnvrvgledslysgkgqlatsnaeqv rkirriieelsldiatpdearamlktkganetsf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.181
    Matthews' coefficent 2.89 Rfactor 0.158
    Waters 316 Solvent Content 57.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e02
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Ligands in crystal structures that aid in functional characterization
    AE Speers, BF Cravatt - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    3. 3-Keto-5-aminohexanoate Cleavage Enzyme
    M Bellinzoni, K Bastard, A Perret, A Zaparucha - Journal of Biological , 2011 - ASBMB
     

    Protein Summary

    Gene Bxe_C0271 from Burkholderia xenovorans lb400 encodes the YP_555544 amino acid sequence that belongs to the DUF849 group (PF05853). Check TOPSAN entry for target 381354 for functional details.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch